PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NF-YB
Protein Properties Length: 87aa    MW: 9753.91 Da    PI: 7.919
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036574genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB109.42.1e-341633597
        NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 +qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy  plk yl +yrelege+
  Lus10036574  1 MQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWALSSLGFDDYCSPLKRYLLRYRELEGER 63
                 79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.37E-24177IPR009072Histone-fold
Gene3DG3DSA:1.10.20.109.3E-31167IPR009072Histone-fold
PfamPF008083.7E-13137IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.6E-18119No hitNo description
PROSITE patternPS006850420IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.6E-182038No hitNo description
PRINTSPR006154.6E-183957No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDVCWALSSL GFDDYCSPLK RYLLRYRELE  60
GERAARSDYN TPPSGAGITR PTTRNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-261583693NF-YB
4awl_B5e-261583794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-261583794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880381e-30AB288038.1 Oryza sativa Japonica Group OsHAP3D gene for HAP3 subunit of HAP complex, complete cds.
GenBankAK2421181e-30AK242118.1 Oryza sativa Japonica Group cDNA, clone: J075146M01, full insert sequence.
GenBankAP0032461e-30AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12.
GenBankAP0032661e-30AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09.
GenBankAP0149571e-30AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126091e-30CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankCT8365731e-30CT836573.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA128I01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368975.11e-39PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822489e-37NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0J8C1942e-39A0A0J8C194_BETVU; Uncharacterized protein
TrEMBLA0A0L9TWP11e-39A0A0L9TWP1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SS711e-39A0A0S3SS71_PHAAN; Uncharacterized protein
STRINGGSMUA_Achr8P10020_0012e-38(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-30nuclear factor Y, subunit B5